Guangdong, China
Business Range:
Chemicals, Health & Medicine, Sporting Goods & Recreation
Main Products:
Management System Certification:
ISO 9001, GMP
Terms of Payment:
T/T, Western Union
International Commercial Terms(Incoterms):
FOB, CIF
OEM/ODM Service
Sample Available

Cjc-1295, Without Dac, Cjc-1295 Without Dac manufacturer / supplier in China, offering Cjc-1295 Raw Steroid Powders / Muscle Peptide Hormone for Bodybuilding, Testoste Propionat Steroid Hormone Powder with Safe Delivery, OA Oxandrolo- Anav- Hormone Powder Muscle Bodybuilding and so on.

Gold Member Since 2015
Audited Supplier
Supplier Homepage Products Pharmaceutical Raw Materials Cjc-1295 Raw Steroid Powders / Muscle Peptide Hormone for Bodybuilding

Cjc-1295 Raw Steroid Powders / Muscle Peptide Hormone for Bodybuilding

Get Latest Price
Min. Order: 1 Kit
Port: Hong Kong, Hong Kong
Production Capacity: 5000kits/Month
Payment Terms: T/T, Western Union, Money Gram, BTC
Transport Package: Special Packing Methods for Different Orders
Specification: 10vials/Kit
Trademark: Huge
Origin: China

You Might Also Like

Loading...

Basic Info

Model NO.: 863288-34-0
JC-1295 without DAC from Peptides


Quick Detail:
 
Product Name: CJC-1295
English name: CJC-1295 (without DAC)
CAS number: 863288-34-0
Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Tyr- Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular formula: C152H252N44O42
Molecular weight: 3367.97
Purity: 98%
Traits: white powder
 
CJC-1295 without DAC, a 29-amino acid peptide with sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2, is a tetrasubstituted peptide analogue of GHRH with D-Ala, Gln, Ala, and Leu substitutions at positions 2, 8, 15, and 27 respectively which can make the peptide more stable. One of its advantages over traditional GHRH is its ability to bioconjugate with serum albumin, thus increasing its half-life and therapeutic window. It accomplishes this by using protecting groups around the amino acids of GHRH typically susceptible to enzymatic degradation. In clinical research, the objective of the peptide was to treat visceral fat deposits in obese AIDS patients, as increased levels of exogenous HGH are presumed to increase lipolysis (fat loss). 
 
How CJC-1295 Works
CJC-1295 acts for much longer than pure GRF. It acts on the pituitary gland and keeps stimulating the release of growth hormone in pulses. The peptide then finds a neucleophilic unit within the blood and reacts with it in order to create a firmer bond. The reason why it acts in pulses is because the axis of the human growth hormone controls how much of the hormone can remain in the body at a time. This maintains the homeostatic environment in the body.

Cjc-1295 Raw Steroid Powders / Muscle Peptide Hormone for Bodybuilding

 
MGF2mg
PEG MGF2mg
CJC-1295 with DAC2mg
CJC-1295 without DAC2mg
PT-14110mg
MT-110mg
MT-210mg
GHRP-25mg
GHRP-210mg
GHRP-65mg
GHRP-610mg
Ipamorelin2mg
Hexarelin2mg
Sermorelin2mg
Oxytocin2mg
TB5002mg
pentadecapeptide BPC 1572mg
Triptorelin2mg
Tesamorelin2mg
Gonadorelin2mg
Gonadorelin10mg
DSIP2mg
Selank5mg
  
  
 
SARMS
NameCAS NO.
Ostarine,MK-2866, Enobosarm841205-47-8
Andarine (S-4)401900-40-1
MK-677, Ibutamoren,mesylate159752-10-0
LGD-40331165910-22-4
GW-501516/Cardarine317318-70-0
AICAR2627-69-2
SR9009137986-29-9
RAD-140118237-47-0
Flibanserin167933-07-5
Coluracetam135463-81-9
Sunifiram314728-85-3
Pirfenidone53179-13-8
YK111370003-76-1

 

Send your message to this supplier

*From:
*To:
avatar Mrs. Sarah
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now