Gold Member Since 2015
Audited Supplier
Shenzhen Huge Bio-Chemical Co., Ltd.

Cjc-1295, Without Dac, Cjc-1295 Without Dac manufacturer / supplier in China, offering Cjc-1295 Raw Steroid Powders / Muscle Peptide Hormone for Bodybuilding, USP Anabolic Steroids Trenbolone Acetate Hormone Powder, Anabolic Steroids 7-Keto-Dhe. a (7-Keto-dehydroepiandrosterone) CAS: 566-19-8 and so on.

(/ )

Supplier Homepage Product Pharmaceutical Raw Materials Cjc-1295 Raw Steroid Powders / Muscle Peptide Hormone for Bodybuilding

Cjc-1295 Raw Steroid Powders / Muscle Peptide Hormone for Bodybuilding

FOB Price: Get Latest Price
Min. Order: 1 Kit
Port: Hong Kong, Hong Kong
Production Capacity: 5000kits/Month
Payment Terms: T/T, Western Union, Money Gram

Request a custom order and have something just for you!

Send Customized Request
Basic Info
  • Model NO.: 863288-34-0
  • Transport Package: Special Packing Methods for Different Orders
  • Origin: China
  • Trademark: Huge
  • Specification: 10vials/Kit
Product Description
JC-1295 without DAC from Peptides

Quick Detail:
Product Name: CJC-1295
English name: CJC-1295 (without DAC)
CAS number: 863288-34-0
Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Tyr- Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular formula: C152H252N44O42
Molecular weight: 3367.97
Purity: 98%
Traits: white powder
CJC-1295 without DAC, a 29-amino acid peptide with sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2, is a tetrasubstituted peptide analogue of GHRH with D-Ala, Gln, Ala, and Leu substitutions at positions 2, 8, 15, and 27 respectively which can make the peptide more stable. One of its advantages over traditional GHRH is its ability to bioconjugate with serum albumin, thus increasing its half-life and therapeutic window. It accomplishes this by using protecting groups around the amino acids of GHRH typically susceptible to enzymatic degradation. In clinical research, the objective of the peptide was to treat visceral fat deposits in obese AIDS patients, as increased levels of exogenous HGH are presumed to increase lipolysis (fat loss). 
How CJC-1295 Works
CJC-1295 acts for much longer than pure GRF. It acts on the pituitary gland and keeps stimulating the release of growth hormone in pulses. The peptide then finds a neucleophilic unit within the blood and reacts with it in order to create a firmer bond. The reason why it acts in pulses is because the axis of the human growth hormone controls how much of the hormone can remain in the body at a time. This maintains the homeostatic environment in the body.

Cjc-1295 Raw Steroid Powders / Muscle Peptide Hormone for Bodybuilding

CJC-1295 with DAC2mg
CJC-1295 without DAC2mg
pentadecapeptide BPC 1572mg
Ostarine,MK-2866, Enobosarm841205-47-8
Andarine (S-4)401900-40-1
MK-677, Ibutamoren,mesylate159752-10-0

Send your message to this supplier
Mrs. Sarah
Trading Manager
To: Mrs. Sarah

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now

Find Similar Products By Category